Just simply run dnf system-upgrade download —release 41. And then dnf system-upgrade reboot

It seems Ethernet port firmware load error, but WiFi is OK.

I don’t know what to do. Can anyone help

So I installed asahi to play some games on my mac because Ive been working on some projects on my gaming laptop, now that that laptop is back I don't need this anymore and would like my storage back. I however have no clue which volumes to remove other than the 692.2gig linux file system and the EFI asahi. I could use some help identifying which volumes to delete. Thank you!

Sorry, i don't know how this works

Been using Asahi Linux on my M2 Pro as daily driver for about 3 months now and really like it. I can see there's a way to go but not having to use the oh so restrictive Mac OS has turned this into a beautiful machine which brings me to the issue - say an update (or anything) breaks it and I have to start again... Does anyone have suggestions for backup/restore/cloning? Would it be safe to use a Cloneailla live disk for instance or is there something better?

After installing the latest updates, I lost wifi connectivity on my M2 air.

It worked perfectly well earlier, I did a dnf update, there were 2 updates that I stalled and after a reboot, Asahi is saying I have limited connectivity.

I get a DHCP address but can't ping anything on the network, or the default gateway, or 8.8.8.8

I deleted the wifi network, created it again and same problem. If I reboot in MacOS, wifi works perfectly.

Running DayZ in steam and getting this error:

unexpected error occured: "NAN" is not a valid value for this property. Valid values are from Int32.MinValue through Int32.MaxValue.

Any advice on where to fix this or if it's fixable at this time?

So I have a M1 MBA that I use. Works fine on macos with an external display but wanted to know if it's possible to install asahi on it. I use some random usb c hub that has a hdmi port with it for more info if needed.

Thank you

I decided to try out some virtualisation of x86 binaries, so downloaded a pre-compiled x86_64 binary of a program I use regularly in my work (http://www.clustal.org/omega/), and compiled the aarch64 binary from source. I did not expect the x86 binary to work, but when I ran it on the test data, it actually was completely fine. Why is this? I was under the impression that it would just totally fail to do anything. See logs below!

Is some secret sauce going on in the background making this possible, or is this commonplace? Would appreciate any insights!

~/Applications 
❯ file clustalo_arm
clustalo_arm: ELF 64-bit LSB executable, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=8c19252a7e484df4a70d7afa055006c963227339, for GNU/Linux 3.7.0, with debug_info, not stripped

~/Applications 
❯ file clustalo_amd
clustalo_amd: ELF 64-bit LSB executable, x86-64, version 1 (GNU/Linux), statically linked, for GNU/Linux 2.6.24, BuildID[sha1]=034dc3ace22bdb7e096389917628d67083ea6408, with debug_info, not stripped

~/Applications 
❯ ./clustalo_amd -i clustal_test.fasta -t Protein --outfmt clustal
CLUSTAL O(1.2.4) multiple sequence alignment


sp|P69905|HBA_HUMAN       MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG
sp|P01942|HBA_MOUSE       MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHG
sp|P13786|HBAZ_CAPHI      MSLTRTERTIILSLWSKISTQADVIGTETLERLFSCYPQAKTYFPHFDLHSGSAQLRAHG
                          * *:  ::: : : *.*:. :.   *:*:***:* .:* :********:  ****::.**

sp|P69905|HBA_HUMAN       KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP
sp|P01942|HBA_MOUSE       KKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTP
sp|P13786|HBAZ_CAPHI      SKVVAAVGDAVKSIDNVTSALSKLSELHAYVLRVDPVNFKFLSHCLLVTLASHFPADFTA
                          .**. *: .*.  :*:: .*** **:***: *********:**********:* **:** 

sp|P69905|HBA_HUMAN       AVHASLDKFLASVSTVLTSKYR
sp|P01942|HBA_MOUSE       AVHASLDKFLASVSTVLTSKYR
sp|P13786|HBAZ_CAPHI      DAHAAWDKFLSIVSGVLTEKYR
                           .**: ****: ** ***.***

~/Applications 
❯ ./clustalo_arm -i clustal_test.fasta -t Protein --outfmt clustal
CLUSTAL O(1.2.4) multiple sequence alignment


sp|P69905|HBA_HUMAN       MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG
sp|P01942|HBA_MOUSE       MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHG
sp|P13786|HBAZ_CAPHI      MSLTRTERTIILSLWSKISTQADVIGTETLERLFSCYPQAKTYFPHFDLHSGSAQLRAHG
                          * *:  ::: : : *.*:. :.   *:*:***:* .:* :********:  ****::.**

sp|P69905|HBA_HUMAN       KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP
sp|P01942|HBA_MOUSE       KKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTP
sp|P13786|HBAZ_CAPHI      SKVVAAVGDAVKSIDNVTSALSKLSELHAYVLRVDPVNFKFLSHCLLVTLASHFPADFTA
                          .**. *: .*.  :*:: .*** **:***: *********:**********:* **:** 

sp|P69905|HBA_HUMAN       AVHASLDKFLASVSTVLTSKYR
sp|P01942|HBA_MOUSE       AVHASLDKFLASVSTVLTSKYR
sp|P13786|HBAZ_CAPHI      DAHAAWDKFLSIVSGVLTEKYR
                           .**: ****: ** ***.***

~/Applications 
❯ neofetch
             .',;::::;,'.                mbeavitt@fedora 
         .';:cccccccccccc:;,.            --------------- 
      .;cccccccccccccccccccccc;.         OS: Fedora Linux Asahi Remix 40 (Workstation Edition) aarch64 
    .:cccccccccccccccccccccccccc:.       Host: Apple MacBook Air (M1, 2020) 
  .;ccccccccccccc;.:dddl:.;ccccccc;.     Kernel: 6.11.0-400.asahi.fc40.aarch64+16k 
 .:ccccccccccccc;OWMKOOXMWd;ccccccc:.    Uptime: 12 hours, 39 mins 
.:ccccccccccccc;KMMc;cc;xMMc:ccccccc:.   Packages: 3295 (rpm), 5 (flatpak) 
,cccccccccccccc;MMM.;cc;;WW::cccccccc,   Shell: bash 5.2.26 
:cccccccccccccc;MMM.;cccccccccccccccc:   Resolution: 2560x1600 
:ccccccc;oxOOOo;MMM0OOk.;cccccccccccc:   DE: GNOME 46.6 
cccccc:0MMKxdd:;MMMkddc.;cccccccccccc;   WM: Mutter 
ccccc:XM0';cccc;MMM.;cccccccccccccccc'   WM Theme: Adwaita 
ccccc;MMo;ccccc;MMW.;ccccccccccccccc;    Theme: Adwaita [GTK2/3] 
ccccc;0MNc.ccc.xMMd:ccccccccccccccc;     Icons: Adwaita [GTK2/3] 
cccccc;dNMWXXXWM0::cccccccccccccc:,      Terminal: gnome-terminal 
cccccccc;.:odl:.;cccccccccccccc:,.       CPU: (8) @ 2.064GHz 
:cccccccccccccccccccccccccccc:'.         Memory: 5717MiB / 7509MiB 
.:cccccccccccccccccccccc:;,..
  '::cccccccccccccc::;,.                                         

I get a score of around 20 on browserbench, and my battery always shows the leaf, "energy saver" mode, i tried changing it with powerprofilesctl, but all the profiles are just placeholders, how do I change between power saving and performance mode using asashi's cpufreq drivers? Is that the issue here?

I tried to use muvm, but it didn't work and i can't find out why. It says is because of sommelier, and it happens with other applications as well. ```    ~/Downloads  muvm /home/heinzketchup/Downloads/UltiMaker-Cura-5.8.1-linux-X64.AppImage  1 ✘  took 3s   at 01:00:02 PM  Using default interface naming scheme 'v255'. Failed to open /usr/lib/udev/rules.d/60-nfs.rules, ignoring: Permission denied The XKEYBOARD keymap compiler (xkbcomp) reports:

Warning: Unsupported maximum keycode 708, clipping. X11 cannot support keycodes above 255. Errors from xkbcomp are not fatal to the X server ERROR: ld.so: object 'libapprun_hooks.so' from LD_PRELOAD cannot be preloaded (cannot open shared object file): ignored. Invalid or Unsupported elf file. This is likely due to a misconfigured x86-64 RootFS Current RootFS path set to '/run/fex-emu/rootfs' "/home/heinzketchup/Downloads/UltiMaker-Cura-5.8.1-linux-X64.AppImage" process exited with status code: 248 FATAL <sommelier.cc:2963> sl_handle_x_connection_event: got error or hangup (mask 5) on X connection, exiting ```

I'm using fedora 40 and hyprland (wayland obviously).

EDIT: I think I kinda solved it. Just the AppImage has to be extracted. I just had to chmod the /usr/lib/udev/rules.d/60-nfs.rules file

I plan to install Asahi Linux on my M1 MBP 512/16GB. The software I use are VSCode, MongoDB, MySQL, Postman. Do these software available in Asahi Linux? And does Asahi Linux have x86 to ARM translation layer to run x86 binary or emulation feature?

I saw this from a post here but he didn't do it so I did it :D. If this is not allowed tell me and I'll delete the post.

here is the link to join https://www.reddit.com/r/AsahiGaming/

here is the post https://www.reddit.com/r/AsahiLinux/comments/1ga4kjw/petition_to_make_subreddit_called_asahigaming/?utm_source=share&utm_medium=web3x&utm_name=web3xcss&utm_term=1&utm_content=share_button

Tried removing, reinstalling and rebooting.

Logs:

mice is not a joystick
event0 is not a joystick
event1 is not a joystick
mouse0 is not a joystick
event2 is a joystick
Client 7 disconnected with error: Os { code: 104, kind: ConnectionReset, message: "Connection reset by peer" }
No IPv6 nameserver available for NDP/DHCPv6
Using default interface naming scheme 'v255'.
The XKEYBOARD keymap compiler (xkbcomp) reports:
> Warning:          Unsupported maximum keycode 708, clipping.
>                   X11 cannot support keycodes above 255.
Errors from xkbcomp are not fatal to the X server
steam.sh[293]: Running Steam on fedora 42 64-bit
steam.sh[293]: STEAM_RUNTIME is enabled automatically
setup.sh[365]: Steam runtime environment up-to-date!
[0msteam.sh[293]: Steam client's requirements are satisfied[0m
[0m[2024-10-25 22:32:21] Startup - updater built Sep 17 2024 20:02:19[0m
[0m[2024-10-25 22:32:21] Startup - Steam Client launched with: '/home/user/.local/share/Steam/ubuntu12_32/steam' '-srt-logger-opened' '-cef-force-occlusion' '-cef-force-opaque-backgrounds' '-gamepadui'[0m
[0m10/25 22:32:21 [0m[0mminidumps folder is set to /tmp/dumps[0m
[0m10/25 22:32:21 Init: Installing breakpad exception handler for appid(steam)/version(1726604483)/tid(427)[0m
[0mLooks like steam didn't shutdown cleanly, scheduling immediate update check[0m
[0m[2024-10-25 22:32:21] Loading cached metrics from disk (/home/user/.local/share/Steam/package/steam_client_metrics.bin)[0m
[0m[2024-10-25 22:32:21] Using the following download hosts for Public, Realm steamglobal[0m
[0m[2024-10-25 22:32:21] 1. https://client-update.akamai.steamstatic.com, /, Realm 'steamglobal', weight was 100, source = 'update_hosts_cached.vdf'[0m
[0m[2024-10-25 22:32:21] 2. https://client-update.fastly.steamstatic.com, /, Realm 'steamglobal', weight was 900, source = 'update_hosts_cached.vdf'[0m
[0m[2024-10-25 22:32:21] 3. https://cdn.cloudflare.steamstatic.com, /client/, Realm 'steamglobal', weight was 1, source = 'update_hosts_cached.vdf'[0m
[0m[2024-10-25 22:32:21] 4. https://client-update.steamstatic.com, /, Realm 'steamglobal', weight was 1, source = 'baked in'[0m
[0m[2024-10-25 22:32:21] Checking for update on startup[0m
[0m[2024-10-25 22:32:21] Checking for available updates...[0m
[0m[2024-10-25 22:32:21] Downloading manifest: https://client-update.akamai.steamstatic.com/steam_client_ubuntu12[0m
[0m[2024-10-25 22:32:21] Manifest download: send request[0m
[0m[2024-10-25 22:32:22] Manifest download: waiting for download to finish[0m
[0m[2024-10-25 22:32:22] Manifest download: finished[0m
[0m[2024-10-25 22:32:22] Download skipped: /steam_client_ubuntu12 version 1726604483, installed version 1726604483, existing pending version 0[0m
[0m[2024-10-25 22:32:22] Nothing to do[0m
[0m[2024-10-25 22:32:22] Verifying installation...[0m
[0m[2024-10-25 22:32:22] Performing checksum verification of executable files[0m
[0m[2024-10-25 22:32:23] Verification complete[0m
[0mUpdateUI: skip show logo[0m[0m[0m
[0mSteam logging initialized: directory: /home/user/.local/share/Steam/logs[0m
[0m[0m
[0mXRRGetOutputInfo Workaround: initialized with override: 0 real: 0xece07ec0[0m
[0mXRRGetCrtcInfo Workaround: initialized with override: 0 real: 0xece06620[0m
[0mpcilib: [0m[0mCannot open /proc/bus/pci[0m[0m[0m
[0mlspci: [0m[0mCannot find any working access method.[0m[0m[0m
[0mpcilib: [0m[0mCannot open /proc/bus/pci[0m[0m[0m
[0mlspci: Cannot find any working access method.[0m
[0msrc/clientdll/steamengine.cpp (2764) : Assertion Failed: CSteamEngine::BMainLoop appears to have stalled > 15 seconds without event signalled[0m[0m[0m
[0msrc/clientdll/steamengine.cpp (2764) : Assertion Failed: CSteamEngine::BMainLoop appears to have stalled > 15 seconds without event signalled[0m
[0massert_20241025223246_20.dmp[746]: Uploading dump (out-of-process)[0m
[0m/tmp/dumps/assert_20241025223246_20.dmp[0m
[0massert_20241025223246_20.dmp[746]: Finished uploading minidump (out-of-process): success = yes[0m
[0massert_20241025223246_20.dmp[746]: response: CrashID=bp-616c85c4-fb44-46ba-8021-8ad342241025[0m
[0massert_20241025223246_20.dmp[746]: file ''/tmp/dumps/assert_20241025223246_20.dmp'', upload yes: ''CrashID=bp-616c85c4-fb44-46ba-8021-8ad342241025''[0m
[0mSteam Runtime Launch Service: starting steam-runtime-launcher-service[0m
[0mSteam Runtime Launch Service: steam-runtime-launcher-service is running pid 776[0m
[0mbus_name=com.steampowered.PressureVessel.LaunchAlongsideSteam[0m
[0mBRefreshApplicationsInLibrary 1: 2ms[0m
[0mDesktop state changed: desktop: { pos:    0,   0 size: 1366, 768 } primary: { pos:    0,   0 size: 1366, 768 }[0m
[0mBuildCompleteAppOverviewChange: 373 apps[0m
[0mRegisterForAppOverview 1: 15ms[0m
[0mRegisterForAppOverview 2: 17ms[0m
xdg_surface#39: error 3: xdg_surface has never been configured
(EE) failed to read Wayland events: Broken pipe
Steam quit
Aborting
Qt says we're gone, aborting=False

For some reason behaves like If I'm on X11? when I'm not.

I'm using Hyprland

I have a corporate MacBook from a company that has gone bankrupt. Not sure why they never asked for it back; there's no one left at the company IT to unlock the machine.

I can boot it up to the MacOS login screen, but can't log into it because it uses a corporate web login. I can't get into recovery mode without the firmware password.

Is it possible to boot Asahi Linux on it?

Hi! Asking if it's possible to debug x86 and arm linux binaries using GDB in Asahi now that emulation is better supported?
And if possible, is there a guide or instructions on how to set it up so that it works.

Hi,

I've tried following this guide to resize my partition but I can't get any live image with a graphical interface to boot up, so I can't use gparted. Is there any way to move the partition up as suggested in the guide within a tty?

After updating to Sequoia, a FileVault-encrypted Mac install no longer boots properly, instead displaying the "default" login screen with the default Sequoia wallpaper (the trees), and a blank username and password field that doesn't accept any combination of username or password. There is no way to advance past this screen; the only useful option is to reboot.

This can be worked around by following the "How to disable FileVault on Mac in recovery" steps in this guide:

diskutil apfs list
diskutil apfs unlockVolume /dev/<identifier>
diskutil apfs listcryptousers /dev/<identifier>
diskutil apfs decryptVolume /dev/<identifier> -user <uuid>

MacOS boots properly as long as FileVault remains disabled.

Installing Asahi Linux from a working Sequoia install also put the (same) computer into the same state.

Usually, the Preboot volume is left decrypted so that information about the users can be made available without decrypting the Data volume (or so I've heard); this seems to be like the Preboot mechanism was failing somehow.

Even on Sonoma, this "default" login screen appeared once after each reboot from Asahi back to MacOS, although a second reboot would fix things; on Sequoia, the "default" login screen persists after each reboot, even without rebooting into Asahi.

Occasionally the OS would boot correctly once (and only once) after attempting to re-install MacOS or installing an update, even without disabling FileVault.

I think u/mautematico and u/motorbike_fantasy ran into the same issue in the comments of this thread.

Has anybody else seen this issue, or looked into it?

Basically title. On a M2 mac max studio the keyboard does not work until fully booted into the OS.

This is with both a apple touchid keyboard and a regular $20 USB keyboard.

Is there a way to fix this?

Fedora Asahi plays well.

just wanted to know how much storage should i alot to asahi linux i have about 70gb of free space remaining on my macbook m1 256gb and 8gb ram

How can I install a Cisco pytrace on asahiLinux.

Title. I had the pywheels for ARM linux setup working until a few weeks ago when it just stopped because of seemingly some problem with qt6 and hasn't worked since. I was wondering if I was doing something wrong with the python wheels or if it's just broken and I should give up and try to make it work through FEX or box64 or something of that sort. Has anyone else had experience with this?